PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_32594g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 89aa    MW: 9523.8 Da    PI: 6.4885
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_32594g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.95.5e-292279260
    ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   ++vrY eC+kNhAas+ g+avDGC Efm+s g+eg+aaa+kCaAC+CHR+FH +eve+e
  MA_32594g0010 22 KGVRYGECRKNHAASIVGYAVDGCAEFMAS-GDEGSAAAMKCAACNCHRSFHMKEVENE 79
                   579**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-202285IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.6E-272476IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.9E-242576IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.0272675IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MILVIEAGSA AAAREEDIAS RKGVRYGECR KNHAASIVGY AVDGCAEFMA SGDEGSAAAM  60
KCAACNCHRS FHMKEVENET LCECHRIRG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1062234e-95BT106223.1 Picea glauca clone GQ02905_E14 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792497.16e-31PREDICTED: mini zinc finger protein 1-like
SwissprotQ9LJW53e-27MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA9NK891e-40A9NK89_PICSI; Putative uncharacterized protein
TrEMBLA9NYD87e-40A9NYD8_PICSI; Putative uncharacterized protein
STRINGVIT_08s0056g01130.t011e-26(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-28mini zinc finger 2